Lineage for d1hj7a1 (1hj7 A:293-333)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258438Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 2258439Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
    Uniprot P01130 272-353
  8. 2258447Domain d1hj7a1: 1hj7 A:293-333 [61071]
    complexed with ca

Details for d1hj7a1

PDB Entry: 1hj7 (more details)

PDB Description: nmr study of a pair of ldl receptor ca2+ binding epidermal growth factor-like domains, 20 structures
PDB Compounds: (A:) ldl receptor

SCOPe Domain Sequences for d1hj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hj7a1 g.3.11.1 (A:293-333) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced

SCOPe Domain Coordinates for d1hj7a1:

Click to download the PDB-style file with coordinates for d1hj7a1.
(The format of our PDB-style files is described here.)

Timeline for d1hj7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hj7a2