SCOPe 2.08: Domain d1hhna1: 1hhn A:189-288

Lineage for d1hhna1 (1hhn A:189-288)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.104: P-domain of calnexin/calreticulin [63886] (1 superfamily)
   non-globular proline-rich hairpin

4. Superfamily b.104.1: P-domain of calnexin/calreticulin [63887] (1 family)

5. Family b.104.1.1: P-domain of calnexin/calreticulin [63888] (2 proteins)
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures
   

6. Protein Calreticulin [63889] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [63890] (3 PDB entries)

8. Domain d1hhna1: 1hhn A:189-288 [61043]
   Other proteins in same PDB: d1hhna2

Details for d1hhna1

PDB Entry: 1hhn

PDB Description: calreticulin p-domain

PDB Compounds: (A:) calreticulin

SCOPe Domain Sequences for d1hhna1:

Sequence; same for both SEQRES and ATOM records:

>d1hhna1 b.104.1.1 (A:189-288) Calreticulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kkikdpdaakpedwderakiddptdskpedwdkpehipdpdakkpedwdeemdgeweppv
iqnpeykgewkprqidnpdykgtwihpeidnpeyspdani

Timeline for d1hhna1:

• d1hhna1 first appeared in SCOP 1.57, called d1hhna_
  
• d1hhna1 appears in SCOPe 2.07