Lineage for d1hh4b1 (1hh4 B:2-189)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124904Protein Rac [52595] (1 species)
  7. 2124905Species Human (Homo sapiens) [TaxId:9606] [52596] (19 PDB entries)
  8. 2124932Domain d1hh4b1: 1hh4 B:2-189 [61038]
    Other proteins in same PDB: d1hh4a2, d1hh4b2, d1hh4d_, d1hh4e_
    rac1 in complex with RhoGD
    complexed with gdp, ger, mg

Details for d1hh4b1

PDB Entry: 1hh4 (more details), 2.7 Å

PDB Description: rac1-rhogdi complex involved in nadph oxidase activation
PDB Compounds: (B:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d1hh4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh4b1 c.37.1.8 (B:2-189) Rac {Human (Homo sapiens) [TaxId: 9606]}
qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq
edydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcppp
vkkrkrkc

SCOPe Domain Coordinates for d1hh4b1:

Click to download the PDB-style file with coordinates for d1hh4b1.
(The format of our PDB-style files is described here.)

Timeline for d1hh4b1: