Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) |
Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein) |
Protein Inovirus (filamentous phage) major coat protein [57989] (8 species) |
Species Bacteriophage ph75, Inovirus ph75 [TaxId:144736] [64591] (3 PDB entries) |
Domain d1hgza_: 1hgz A: [61034] |
PDB Entry: 1hgz (more details), 2.4 Å
SCOPe Domain Sequences for d1hgza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hgza_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage ph75, Inovirus ph75 [TaxId: 144736]} mdfnpsevasqvtnyiqaiaaagvgvlalaiglsaawkyakrflkg
Timeline for d1hgza_: