Lineage for d1hgva_ (1hgv A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039816Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family) (S)
  5. 3039817Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)
  6. 3039818Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)
  7. 3039852Species Bacteriophage ph75, Inovirus ph75 [TaxId:144736] [64591] (3 PDB entries)
  8. 3039854Domain d1hgva_: 1hgv A: [61033]

Details for d1hgva_

PDB Entry: 1hgv (more details), 2.4 Å

PDB Description: filamentous bacteriophage ph75
PDB Compounds: (A:) ph75 inovirus major coat protein

SCOPe Domain Sequences for d1hgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgva_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage ph75, Inovirus ph75 [TaxId: 144736]}
mdfnpsevasqvtnyiqaiaaagvgvlalaiglsaawkyakrflkg

SCOPe Domain Coordinates for d1hgva_:

Click to download the PDB-style file with coordinates for d1hgva_.
(The format of our PDB-style files is described here.)

Timeline for d1hgva_: