Lineage for d1hg2a_ (1hg2 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 217299Superfamily a.118.10: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48473] (1 family) (S)
  5. 217300Family a.118.10.1: Phosphoinositide-binding clathrin adaptor, N-terminal domain [48474] (2 proteins)
  6. 217305Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [48475] (1 species)
  7. 217306Species Rat (Rattus norvegicus) [TaxId:10116] [48476] (4 PDB entries)
  8. 217308Domain d1hg2a_: 1hg2 A: [61024]
    complex with inositol(4,5)p2
    complexed with ip2

Details for d1hg2a_

PDB Entry: 1hg2 (more details), 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(4,5)p2 complex

SCOP Domain Sequences for d1hg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hg2a_ a.118.10.1 (A:) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus)}
gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks
litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy
rqvafdftkvkrgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafm
llfkdairlfaaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvg
idrgdipdlsqapsslldaleqh

SCOP Domain Coordinates for d1hg2a_:

Click to download the PDB-style file with coordinates for d1hg2a_.
(The format of our PDB-style files is described here.)

Timeline for d1hg2a_: