Lineage for d1hf2c2 (1hf2 C:1-99)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75771Fold c.102: Cell-division inhibitor MinC, N-terminal domain [64042] (1 superfamily)
  4. 75772Superfamily c.102.1: Cell-division inhibitor MinC, N-terminal domain [64043] (1 family) (S)
  5. 75773Family c.102.1.1: Cell-division inhibitor MinC, N-terminal domain [64044] (1 protein)
  6. 75774Protein Cell-division inhibitor MinC, N-terminal domain [64045] (1 species)
  7. 75775Species Thermotoga maritima [TaxId:243274] [64046] (1 PDB entry)
  8. 75778Domain d1hf2c2: 1hf2 C:1-99 [60997]
    Other proteins in same PDB: d1hf2a1, d1hf2b1, d1hf2c1, d1hf2d1

Details for d1hf2c2

PDB Entry: 1hf2 (more details), 2.2 Å

PDB Description: crystal structure of the bacterial cell-division inhibitor minc from t. maritima

SCOP Domain Sequences for d1hf2c2:

Sequence, based on SEQRES records: (download)

>d1hf2c2 c.102.1.1 (C:1-99) Cell-division inhibitor MinC, N-terminal domain {Thermotoga maritima}
mvdfkmtkeglvllikdyqnleevlnaisaritqmggffakgdrislmienhnkhsqdip
rivshlrnlglevsqilvgstvegkendlkvqsrttves

Sequence, based on observed residues (ATOM records): (download)

>d1hf2c2 c.102.1.1 (C:1-99) Cell-division inhibitor MinC, N-terminal domain {Thermotoga maritima}
mvdfkmtkeglvllikdyqnleevlnaisaritqmggffakgdrislmienhnkhsqdip
rivshlrnlglevsqilvgstvedlkvqsrttves

SCOP Domain Coordinates for d1hf2c2:

Click to download the PDB-style file with coordinates for d1hf2c2.
(The format of our PDB-style files is described here.)

Timeline for d1hf2c2: