SCOP 1.57: Domain d1hf2b2: 1hf2 B:2-99

Lineage for d1hf2b2 (1hf2 B:2-99)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.102: Cell-division inhibitor MinC, N-terminal domain [64042] (1 superfamily)

4. Superfamily c.102.1: Cell-division inhibitor MinC, N-terminal domain [64043] (1 family)

5. Family c.102.1.1: Cell-division inhibitor MinC, N-terminal domain [64044] (1 protein)

6. Protein Cell-division inhibitor MinC, N-terminal domain [64045] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [64046] (1 PDB entry)

8. Domain d1hf2b2: 1hf2 B:2-99 [60995]
   Other proteins in same PDB: d1hf2a1, d1hf2b1, d1hf2c1, d1hf2d1

Details for d1hf2b2

PDB Entry: 1hf2, 2.2 Å

PDB Description: crystal structure of the bacterial cell-division inhibitor minc from t. maritima

SCOP Domain Sequences for d1hf2b2:

Sequence; same for both SEQRES and ATOM records:

>d1hf2b2 c.102.1.1 (B:2-99) Cell-division inhibitor MinC, N-terminal domain {Thermotoga maritima}
vdfkmtkeglvllikdyqnleevlnaisaritqmggffakgdrislmienhnkhsqdipr
ivshlrnlglevsqilvgstvegkendlkvqsrttves

Timeline for d1hf2b2:

• d1hf2b2 is new in SCOP 1.57
  
• d1hf2b2 appears in SCOP 1.59
  
• d1hf2b2 appears in the current release, SCOPe 2.08