Lineage for d1hf2b2 (1hf2 B:2-99)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919229Fold c.102: Cell-division inhibitor MinC, N-terminal domain [64042] (1 superfamily)
    beta(2)-(alpha-beta)2-beta; 2 layers, a/b; mixed beta-sheet of 5 strands, order 12345; strands 1 & 5 are antiparallel to the rest
  4. 2919230Superfamily c.102.1: Cell-division inhibitor MinC, N-terminal domain [64043] (1 family) (S)
    automatically mapped to Pfam PF05209
  5. 2919231Family c.102.1.1: Cell-division inhibitor MinC, N-terminal domain [64044] (1 protein)
  6. 2919232Protein Cell-division inhibitor MinC, N-terminal domain [64045] (1 species)
  7. 2919233Species Thermotoga maritima [TaxId:2336] [64046] (1 PDB entry)
  8. 2919235Domain d1hf2b2: 1hf2 B:2-99 [60995]
    Other proteins in same PDB: d1hf2a1, d1hf2b1, d1hf2c1, d1hf2d1

Details for d1hf2b2

PDB Entry: 1hf2 (more details), 2.2 Å

PDB Description: crystal structure of the bacterial cell-division inhibitor minc from t. maritima
PDB Compounds: (B:) septum site-determining protein minc

SCOPe Domain Sequences for d1hf2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf2b2 c.102.1.1 (B:2-99) Cell-division inhibitor MinC, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
vdfkmtkeglvllikdyqnleevlnaisaritqmggffakgdrislmienhnkhsqdipr
ivshlrnlglevsqilvgstvegkendlkvqsrttves

SCOPe Domain Coordinates for d1hf2b2:

Click to download the PDB-style file with coordinates for d1hf2b2.
(The format of our PDB-style files is described here.)

Timeline for d1hf2b2: