![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.102: Cell-division inhibitor MinC, N-terminal domain [64042] (1 superfamily) beta(2)-(alpha-beta)2-beta; 2 layers, a/b; mixed beta-sheet of 5 strands, order 12345; strands 1 & 5 are antiparallel to the rest |
![]() | Superfamily c.102.1: Cell-division inhibitor MinC, N-terminal domain [64043] (1 family) ![]() automatically mapped to Pfam PF05209 |
![]() | Family c.102.1.1: Cell-division inhibitor MinC, N-terminal domain [64044] (1 protein) |
![]() | Protein Cell-division inhibitor MinC, N-terminal domain [64045] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [64046] (1 PDB entry) |
![]() | Domain d1hf2a2: 1hf2 A:1-99 [60993] Other proteins in same PDB: d1hf2a1, d1hf2b1, d1hf2c1, d1hf2d1 |
PDB Entry: 1hf2 (more details), 2.2 Å
SCOPe Domain Sequences for d1hf2a2:
Sequence, based on SEQRES records: (download)
>d1hf2a2 c.102.1.1 (A:1-99) Cell-division inhibitor MinC, N-terminal domain {Thermotoga maritima [TaxId: 2336]} mvdfkmtkeglvllikdyqnleevlnaisaritqmggffakgdrislmienhnkhsqdip rivshlrnlglevsqilvgstvegkendlkvqsrttves
>d1hf2a2 c.102.1.1 (A:1-99) Cell-division inhibitor MinC, N-terminal domain {Thermotoga maritima [TaxId: 2336]} mvdfkmtkeglvllikdyqnleevlnaisaritqmggffakgdrislmienhnkhsqdip rivshlrnlglevsqilvgkvqsrttves
Timeline for d1hf2a2: