Lineage for d1hf2a1 (1hf2 A:100-206)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63489Fold b.80: Single-stranded right-handed beta-helix [51125] (3 superfamilies)
  4. 63561Superfamily b.80.3: Cell-division inhibitor MinC, C-terminal domain [63848] (1 family) (S)
  5. 63562Family b.80.3.1: Cell-division inhibitor MinC, C-terminal domain [63849] (1 protein)
    this is a repeat family; one repeat unit is 1hf2 A:117-135 found in domain
  6. 63563Protein Cell-division inhibitor MinC, C-terminal domain [63850] (1 species)
  7. 63564Species Thermotoga maritima [TaxId:243274] [63851] (1 PDB entry)
  8. 63565Domain d1hf2a1: 1hf2 A:100-206 [60992]
    Other proteins in same PDB: d1hf2a2, d1hf2b2, d1hf2c2, d1hf2d2

Details for d1hf2a1

PDB Entry: 1hf2 (more details), 2.2 Å

PDB Description: crystal structure of the bacterial cell-division inhibitor minc from t. maritima

SCOP Domain Sequences for d1hf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf2a1 b.80.3.1 (A:100-206) Cell-division inhibitor MinC, C-terminal domain {Thermotoga maritima}
tgkvikrnirsgqtvvhsgdvivfgnvnkgaeilaggsvvvfgkaqgniraglneggqav
vaaldlqtsliqiagfithskgeenvpsiahvkgnriviepfdkvsf

SCOP Domain Coordinates for d1hf2a1:

Click to download the PDB-style file with coordinates for d1hf2a1.
(The format of our PDB-style files is described here.)

Timeline for d1hf2a1: