![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
![]() | Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) |
![]() | Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
![]() | Species Peptostreptococcus magnus [TaxId:1260] [54363] (10 PDB entries) |
![]() | Domain d1heze_: 1hez E: [60991] Other proteins in same PDB: d1heza1, d1heza2, d1hezb1, d1hezb2, d1hezc1, d1hezc2, d1hezd1, d1hezd2 |
PDB Entry: 1hez (more details), 2.7 Å
SCOP Domain Sequences for d1heze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1heze_ d.15.7.1 (E:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus} evtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytadledggnhmnikf a
Timeline for d1heze_: