Lineage for d1hezd2 (1hez D:122-224)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934278Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 934279Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)
  8. 934286Domain d1hezd2: 1hez D:122-224 [60990]
    Other proteins in same PDB: d1heza1, d1heza2, d1hezb1, d1hezc1, d1hezc2, d1hezd1, d1heze_
    part of IgM rheumatoid factor Fab
    complexed with imd

Details for d1hezd2

PDB Entry: 1hez (more details), 2.7 Å

PDB Description: structure of p. magnus protein l bound to a human igm fab.
PDB Compounds: (D:) heavy chain of ig

SCOPe Domain Sequences for d1hezd2:

Sequence, based on SEQRES records: (download)

>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvplp

Sequence, based on observed residues (ATOM records): (download)

>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscenstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggky
aatsqvllpsnehvvckvqhpngnkekdvplp

SCOPe Domain Coordinates for d1hezd2:

Click to download the PDB-style file with coordinates for d1hezd2.
(The format of our PDB-style files is described here.)

Timeline for d1hezd2: