SCOP 1.63: Domain d1hezd2: 1hez D:122-224

Lineage for d1hezd2 (1hez D:122-224)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab of human IgM RF 2A2 [49101] (2 PDB entries)

8. Domain d1hezd2: 1hez D:122-224 [60990]
   Other proteins in same PDB: d1heza1, d1hezb1, d1hezc1, d1hezd1, d1heze_
   complexed with imd

Details for d1hezd2

PDB Entry: 1hez, 2.7 Å

PDB Description: structure of p. magnus protein l bound to a human igm fab.

SCOP Domain Sequences for d1hezd2:

Sequence, based on SEQRES records:

>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvplp

Sequence, based on observed residues (ATOM records):

>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2}
gsasaptlfplvscenstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggky
aatsqvllpsnehvvckvqhpngnkekdvplp

Timeline for d1hezd2:

• d1hezd2 first appeared in SCOP 1.57
  
• d1hezd2 appears in SCOP 1.61
  
• d1hezd2 appears in SCOP 1.65
  
• d1hezd2 appears in the current release, SCOPe 2.08