Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab of human IgM RF 2A2 [49101] (2 PDB entries) |
Domain d1hezd2: 1hez D:122-224 [60990] Other proteins in same PDB: d1heza1, d1hezb1, d1hezc1, d1hezd1, d1heze_ complexed with imd |
PDB Entry: 1hez (more details), 2.7 Å
SCOP Domain Sequences for d1hezd2:
Sequence, based on SEQRES records: (download)
>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2} gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvplp
>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2} gsasaptlfplvscenstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggky aatsqvllpsnehvvckvqhpngnkekdvplp
Timeline for d1hezd2: