Lineage for d1hezd2 (1hez D:122-224)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221649Species Fab of human IgM RF 2A2 [49101] (2 PDB entries)
  8. 221659Domain d1hezd2: 1hez D:122-224 [60990]
    Other proteins in same PDB: d1heza1, d1hezb1, d1hezc1, d1hezd1, d1heze_
    complexed with imd

Details for d1hezd2

PDB Entry: 1hez (more details), 2.7 Å

PDB Description: antibody-antigen complex

SCOP Domain Sequences for d1hezd2:

Sequence, based on SEQRES records: (download)

>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvplp

Sequence, based on observed residues (ATOM records): (download)

>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2}
gsasaptlfplvscenstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggky
aatsqvllpsnehvvckvqhpngnkekdvplp

SCOP Domain Coordinates for d1hezd2:

Click to download the PDB-style file with coordinates for d1hezd2.
(The format of our PDB-style files is described here.)

Timeline for d1hezd2: