Lineage for d1hezd1 (1hez D:1-121)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102858Species Fab of human IgM RF 2A2 [48896] (2 PDB entries)
  8. 102868Domain d1hezd1: 1hez D:1-121 [60989]
    Other proteins in same PDB: d1heza2, d1hezb2, d1hezc2, d1hezd2, d1heze_

Details for d1hezd1

PDB Entry: 1hez (more details), 2.7 Å

PDB Description: antibody-antigen complex

SCOP Domain Sequences for d1hezd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hezd1 b.1.1.1 (D:1-121) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2}
qvqlvesgggvvqpgrslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
s

SCOP Domain Coordinates for d1hezd1:

Click to download the PDB-style file with coordinates for d1hezd1.
(The format of our PDB-style files is described here.)

Timeline for d1hezd1: