![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Fab of human IgM RF 2A2 [48896] (2 PDB entries) |
![]() | Domain d1hezd1: 1hez D:1-121 [60989] Other proteins in same PDB: d1heza2, d1hezb2, d1hezc2, d1hezd2, d1heze_ |
PDB Entry: 1hez (more details), 2.7 Å
SCOP Domain Sequences for d1hezd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hezd1 b.1.1.1 (D:1-121) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2} qvqlvesgggvvqpgrslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs s
Timeline for d1hezd1: