![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
![]() | Species Fab of human IgM RF 2A2 [49101] (2 PDB entries) |
![]() | Domain d1hezc2: 1hez C:108-214 [60988] Other proteins in same PDB: d1heza1, d1hezb1, d1hezc1, d1hezd1, d1heze_ |
PDB Entry: 1hez (more details), 2.7 Å
SCOP Domain Sequences for d1hezc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hezc2 b.1.1.2 (C:108-214) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1hezc2: