SCOP 1.65: Domain d1hezc1: 1hez C:1-107

Lineage for d1hezc1 (1hez C:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (16 PDB entries)

8. Domain d1hezc1: 1hez C:1-107 [60987]
   Other proteins in same PDB: d1heza2, d1hezb1, d1hezb2, d1hezc2, d1hezd1, d1hezd2, d1heze_
   part of IgM RF 2A2
   complexed with imd

Details for d1hezc1

PDB Entry: 1hez, 2.7 Å

PDB Description: structure of p. magnus protein l bound to a human igm fab.

SCOP Domain Sequences for d1hezc1:

Sequence; same for both SEQRES and ATOM records:

>d1hezc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystprtfgqgtkveik

Timeline for d1hezc1:

• d1hezc1 first appeared in SCOP 1.57
  
• d1hezc1 appears in SCOP 1.63
  
• d1hezc1 appears in SCOP 1.67
  
• d1hezc1 appears in the current release, SCOPe 2.08