Lineage for d1hezc1 (1hez C:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219910Species Fab of human IgM RF 2A2 [48896] (2 PDB entries)
  8. 219919Domain d1hezc1: 1hez C:1-107 [60987]
    Other proteins in same PDB: d1heza2, d1hezb2, d1hezc2, d1hezd2, d1heze_

Details for d1hezc1

PDB Entry: 1hez (more details), 2.7 Å

PDB Description: antibody-antigen complex
PDB Compounds: (C:)

SCOP Domain Sequences for d1hezc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hezc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2}
diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps
rfsgsgsgtdftltisslqpedfatyycqqsystprtfgqgtkveik

SCOP Domain Coordinates for d1hezc1:

Click to download the PDB-style file with coordinates for d1hezc1.
(The format of our PDB-style files is described here.)

Timeline for d1hezc1: