Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries) |
Domain d1hezb2: 1hez B:122-224 [60986] Other proteins in same PDB: d1heza1, d1heza2, d1hezb1, d1hezc1, d1hezc2, d1hezd1, d1heze_ part of IgM rheumatoid factor Fab |
PDB Entry: 1hez (more details), 2.7 Å
SCOP Domain Sequences for d1hezb2:
Sequence, based on SEQRES records: (download)
>d1hezb2 b.1.1.2 (B:122-224) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvplp
>d1hezb2 b.1.1.2 (B:122-224) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats qvllpshvvckvqhpngnkekdvplp
Timeline for d1hezb2: