SCOP 1.57: Domain d1hezb1: 1hez B:1-121

Lineage for d1hezb1 (1hez B:1-121)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab of human IgM RF 2A2 [48896] (2 PDB entries)

8. Domain d1hezb1: 1hez B:1-121 [60985]
   Other proteins in same PDB: d1heza2, d1hezb2, d1hezc2, d1hezd2, d1heze_

Details for d1hezb1

PDB Entry: 1hez, 2.7 Å

PDB Description: structure of p. magnus protein l bound to a human igm fab.

SCOP Domain Sequences for d1hezb1:

Sequence; same for both SEQRES and ATOM records:

>d1hezb1 b.1.1.1 (B:1-121) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2}
qvqlvesgggvvqpgrslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
s

Timeline for d1hezb1:

• d1hezb1 is new in SCOP 1.57
  
• d1hezb1 appears in SCOP 1.59
  
• d1hezb1 appears in the current release, SCOPe 2.08