Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.11: Bacterial GAP domain [47233] (1 family) contains extra helices in the loops at one end of the bundle |
Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins) |
Protein ExoS toxin [47235] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [47236] (2 PDB entries) |
Domain d1he9a1: 1he9 A:102-234 [60971] Other proteins in same PDB: d1he9a2 |
PDB Entry: 1he9 (more details), 2.4 Å
SCOPe Domain Sequences for d1he9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1he9a1 a.24.11.1 (A:102-234) ExoS toxin {Pseudomonas aeruginosa [TaxId: 287]} kqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalagiragsqv eesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvmsevallr qavesevsrvsad
Timeline for d1he9a1: