SCOPe 2.07: Domain d1he9a1: 1he9 A:102-234

Lineage for d1he9a1 (1he9 A:102-234)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.11: Bacterial GAP domain [47233] (1 family)
   contains extra helices in the loops at one end of the bundle

5. Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins)

6. Protein ExoS toxin [47235] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [47236] (2 PDB entries)

8. Domain d1he9a1: 1he9 A:102-234 [60971]
   Other proteins in same PDB: d1he9a2

Details for d1he9a1

PDB Entry: 1he9, 2.4 Å

PDB Description: crystal structure of the gap domain of the pseudomonas aeruginosa exos toxin

PDB Compounds: (A:) exoenzyme s

SCOPe Domain Sequences for d1he9a1:

Sequence; same for both SEQRES and ATOM records:

>d1he9a1 a.24.11.1 (A:102-234) ExoS toxin {Pseudomonas aeruginosa [TaxId: 287]}
kqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalagiragsqv
eesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvmsevallr
qavesevsrvsad

Timeline for d1he9a1:

• d1he9a1 first appeared in SCOP 1.57, called d1he9a_
  
• d1he9a1 appears in SCOPe 2.06
  
• d1he9a1 appears in the current release, SCOPe 2.08