Lineage for d1ha3b2 (1ha3 B:313-405)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60248Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)
  4. 60249Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) (S)
  5. 60250Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)
  6. 60257Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 60281Species Thermus thermophilus [TaxId:274] [50470] (3 PDB entries)
  8. 60284Domain d1ha3b2: 1ha3 B:313-405 [60873]
    Other proteins in same PDB: d1ha3a1, d1ha3a3, d1ha3b1, d1ha3b3

Details for d1ha3b2

PDB Entry: 1ha3 (more details), 2 Å

PDB Description: elongation factor tu in complex with aurodox

SCOP Domain Sequences for d1ha3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha3b2 b.44.1.1 (B:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1ha3b2:

Click to download the PDB-style file with coordinates for d1ha3b2.
(The format of our PDB-style files is described here.)

Timeline for d1ha3b2: