Lineage for d1ha3a2 (1ha3 A:313-405)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792475Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792476Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1792477Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1792505Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1792536Species Thermus thermophilus [TaxId:274] [50470] (4 PDB entries)
  8. 1792538Domain d1ha3a2: 1ha3 A:313-405 [60870]
    Other proteins in same PDB: d1ha3a1, d1ha3a3, d1ha3b1, d1ha3b3
    complexed with bme, gdp, mau, mg

Details for d1ha3a2

PDB Entry: 1ha3 (more details), 2 Å

PDB Description: elongation factor tu in complex with aurodox
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1ha3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha3a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d1ha3a2:

Click to download the PDB-style file with coordinates for d1ha3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ha3a2: