Lineage for d1ha3a2 (1ha3 A:313-405)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801707Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801708Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 801709Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 801737Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 801766Species Thermus thermophilus [TaxId:274] [50470] (7 PDB entries)
  8. 801770Domain d1ha3a2: 1ha3 A:313-405 [60870]
    Other proteins in same PDB: d1ha3a1, d1ha3a3, d1ha3b1, d1ha3b3

Details for d1ha3a2

PDB Entry: 1ha3 (more details), 2 Å

PDB Description: elongation factor tu in complex with aurodox
PDB Compounds: (A:) elongation factor tu

SCOP Domain Sequences for d1ha3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha3a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1ha3a2:

Click to download the PDB-style file with coordinates for d1ha3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ha3a2: