SCOPe 2.04: Domain d1ha3a1: 1ha3 A:213-312

Lineage for d1ha3a1 (1ha3 A:213-312)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
   N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
7. Species Thermus thermophilus [TaxId:274] [50452] (4 PDB entries)

8. Domain d1ha3a1: 1ha3 A:213-312 [60869]
   Other proteins in same PDB: d1ha3a2, d1ha3a3, d1ha3b2, d1ha3b3
   complexed with bme, gdp, mau, mg

Details for d1ha3a1

PDB Entry: 1ha3, 2 Å

PDB Description: elongation factor tu in complex with aurodox

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1ha3a1:

Sequence; same for both SEQRES and ATOM records:

>d1ha3a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

Timeline for d1ha3a1:

• d1ha3a1 first appeared in SCOP 1.57
  
• d1ha3a1 appears in SCOPe 2.03
  
• d1ha3a1 appears in SCOPe 2.05
  
• d1ha3a1 appears in the current release, SCOPe 2.08