Class a: All alpha proteins [46456] (284 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) the C-terminal domain is a 8-bladed beta-propeller |
Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries) formerly Thiosphaera pantotropha |
Domain d1h9yb1: 1h9y B:49-133 [60861] Other proteins in same PDB: d1h9ya2, d1h9yb2 complexed with cn, dhe, hec, so4 |
PDB Entry: 1h9y (more details), 2.4 Å
SCOP Domain Sequences for d1h9yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h9yb1 a.3.1.2 (B:49-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]} lsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpn wgtsgelsaeqvdlmanyllldpaa
Timeline for d1h9yb1: