Lineage for d1h9va2 (1h9v A:89-172)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787102Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 787103Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries)
  8. 787107Domain d1h9va2: 1h9v A:89-172 [60852]

Details for d1h9va2

PDB Entry: 1h9v (more details), 3 Å

PDB Description: human fc-gamma-receptor iia (fcgriia), monoclinic
PDB Compounds: (A:) low affinity immunoglobulin gamma fc receptor II-a

SCOP Domain Sequences for d1h9va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9va2 b.1.1.4 (A:89-172) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa [TaxId: 9606]}
vlqtphlefqegetimlrchswkdkplvkvtffqngksqkfsrldptfsipqanhshsgd
yhctgnigytlfsskpvtitvqvp

SCOP Domain Coordinates for d1h9va2:

Click to download the PDB-style file with coordinates for d1h9va2.
(The format of our PDB-style files is described here.)

Timeline for d1h9va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9va1