Lineage for d1h9va2 (1h9v A:89-172)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.4: I set domains [49159] (25 proteins) 
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) 
Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries) 
Domain d1h9va2: 1h9v A:89-172 [60852]
Details for d1h9va2
PDB Entry: 1h9v (more details), 3 Å
PDB Description: human fc-gamma-receptor iia (fcgriia), monoclinic
SCOP Domain Sequences for d1h9va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h9va2 b.1.1.4 (A:89-172) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa}
vlqtphlefqegetimlrchswkdkplvkvtffqngksqkfsrldptfsipqanhshsgd
yhctgnigytlfsskpvtitvqvp
SCOP Domain Coordinates for d1h9va2:
Click to download the PDB-style file with coordinates for d1h9va2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h9va2:
- d1h9va2 first appeared in SCOP 1.57
- d1h9va2 appears in SCOP 1.61
- d1h9va2 appears in the current release, SCOPe 2.08
View in 3D
