Lineage for d1h9va1 (1h9v A:1-88)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54288Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
  7. 54289Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries)
  8. 54292Domain d1h9va1: 1h9v A:1-88 [60851]

Details for d1h9va1

PDB Entry: 1h9v (more details), 3 Å

PDB Description: human fc-gamma-receptor iia (fcgriia), monoclinic

SCOP Domain Sequences for d1h9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9va1 b.1.1.4 (A:1-88) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa}
appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvlsewl

SCOP Domain Coordinates for d1h9va1:

Click to download the PDB-style file with coordinates for d1h9va1.
(The format of our PDB-style files is described here.)

Timeline for d1h9va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9va2