Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins) duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands automatically mapped to Pfam PF03459 |
Protein Cytoplasmic molybdate-binding protein ModG [63776] (1 species) |
Species Azotobacter vinelandii [TaxId:354] [63777] (3 PDB entries) |
Domain d1h9ja1: 1h9j A:1-73 [60829] Other proteins in same PDB: d1h9ja3 complexed with moo, po4 |
PDB Entry: 1h9j (more details), 1.8 Å
SCOPe Domain Sequences for d1h9ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h9ja1 b.40.6.2 (A:1-73) Cytoplasmic molybdate-binding protein ModG {Azotobacter vinelandii [TaxId: 354]} mkisarnvfkgtvsalkegavnaevdillgggdklaavvtlesarslqlaagkevvavvk apwvllmtdssgy
Timeline for d1h9ja1: