Lineage for d1h9ja1 (1h9j A:1-73)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790988Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2791035Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
    duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
    automatically mapped to Pfam PF03459
  6. 2791062Protein Cytoplasmic molybdate-binding protein ModG [63776] (1 species)
  7. 2791063Species Azotobacter vinelandii [TaxId:354] [63777] (3 PDB entries)
  8. 2791068Domain d1h9ja1: 1h9j A:1-73 [60829]
    Other proteins in same PDB: d1h9ja3
    complexed with moo, po4

Details for d1h9ja1

PDB Entry: 1h9j (more details), 1.8 Å

PDB Description: two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. phosphate-grown form with molybdate and phosphate bound
PDB Compounds: (A:) molybdenum-binding-protein

SCOPe Domain Sequences for d1h9ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9ja1 b.40.6.2 (A:1-73) Cytoplasmic molybdate-binding protein ModG {Azotobacter vinelandii [TaxId: 354]}
mkisarnvfkgtvsalkegavnaevdillgggdklaavvtlesarslqlaagkevvavvk
apwvllmtdssgy

SCOPe Domain Coordinates for d1h9ja1:

Click to download the PDB-style file with coordinates for d1h9ja1.
(The format of our PDB-style files is described here.)

Timeline for d1h9ja1: