Lineage for d1h96a_ (1h96 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638521Protein (Apo)ferritin [47246] (7 species)
  7. 638601Species Mouse (Mus musculus) [TaxId:10090] [63526] (2 PDB entries)
  8. 638603Domain d1h96a_: 1h96 A: [60811]
    complexed with cd, so4; mutant

Details for d1h96a_

PDB Entry: 1h96 (more details), 1.6 Å

PDB Description: recombinant mouse l-chain ferritin
PDB Compounds: (A:) ferritin light chain 1

SCOP Domain Sequences for d1h96a_:

Sequence, based on SEQRES records: (download)

>d1h96a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]}
tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre
gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar
adphlcdfleshyldkevklikkmgnhltnlrrvagpqpaqtgapqgslgeylferltlk

Sequence, based on observed residues (ATOM records): (download)

>d1h96a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]}
tsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekre
gaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsar
adphlcdfleshyldkevklikkmgnhltnlrrvagslgeylferltlk

SCOP Domain Coordinates for d1h96a_:

Click to download the PDB-style file with coordinates for d1h96a_.
(The format of our PDB-style files is described here.)

Timeline for d1h96a_: