Lineage for d1h8ya_ (1h8y A:)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742172Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 742173Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 742174Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)
  6. 742385Protein Class D beta-lactamase [56622] (4 species)
  7. 742428Species Pseudomonas aeruginosa, OXA-13 [TaxId:287] [64474] (3 PDB entries)
  8. 742433Domain d1h8ya_: 1h8y A: [60801]

Details for d1h8ya_

PDB Entry: 1h8y (more details), 2 Å

PDB Description: Crystal structure of the class D beta-lactamase OXA-13 in complex with meropenem
PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d1h8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ya_ e.3.1.1 (A:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-13 [TaxId: 287]}
ssitentswnkefsaeavngvfvlckssskscatnnlaraskeylpastfkipsaiigle
tgviknehqvfkwdgkpramkqwerdlslrgaiqvsavpvfqqiarevgevrmqkylkkf
sygnqnisggidkfwlegqlrisavnqvefleslflnklsaskenqlivkealvteaape
ylvhsktgfsgvgtesnpgvawwvgwvekgtevyffafnmdidnenklplrksiptkima
segiigg

SCOP Domain Coordinates for d1h8ya_:

Click to download the PDB-style file with coordinates for d1h8ya_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h8yb_