SCOP 1.63: Domain d1h8sb1: 1h8s B:4-112

Lineage for d1h8sb1 (1h8s B:4-112)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-ampicillin scFv, (mouse), kappa L chain [63645] (4 PDB entries)

8. Domain d1h8sb1: 1h8s B:4-112 [60791]

Details for d1h8sb1

PDB Entry: 1h8s, 2.4 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment complexed with the hapten.

SCOP Domain Sequences for d1h8sb1:

Sequence; same for both SEQRES and ATOM records:

>d1h8sb1 b.1.1.1 (B:4-112) Immunoglobulin (variable domains of L and H chains) {Anti-ampicillin scFv, (mouse), kappa L chain}
divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrg

Timeline for d1h8sb1:

• d1h8sb1 first appeared in SCOP 1.57
  
• d1h8sb1 appears in SCOP 1.61
  
• d1h8sb1 appears in SCOP 1.65
  
• d1h8sb1 appears in the current release, SCOPe 2.08