SCOP 1.65: Domain d1h8sa1: 1h8s A:4-111

Lineage for d1h8sa1 (1h8s A:4-111)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)

8. Domain d1h8sa1: 1h8s A:4-111 [60789]
   Other proteins in same PDB: d1h8sa2, d1h8sb2

Details for d1h8sa1

PDB Entry: 1h8s, 2.4 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment complexed with the hapten.

SCOP Domain Sequences for d1h8sa1:

Sequence; same for both SEQRES and ATOM records:

>d1h8sa1 b.1.1.1 (A:4-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkr

Timeline for d1h8sa1:

• d1h8sa1 first appeared in SCOP 1.57
  
• d1h8sa1 appears in SCOP 1.63
  
• d1h8sa1 appears in SCOP 1.67
  
• d1h8sa1 appears in the current release, SCOPe 2.08