SCOP 1.75: Domain d1h8oa1: 1h8o A:4-111

Lineage for d1h8oa1 (1h8o A:4-111)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (182 PDB entries)
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7
   SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region)
   SQ NA # humanized antibody
   SQ NA # part of Fab 28 against HIV-1 RT
   Uniprot P01642 21-115 #
   KV5I_MOUSE Ig kappa chain V-V region L7 precursor
   Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

8. Domain d1h8oa1: 1h8o A:4-111 [60785]
   Other proteins in same PDB: d1h8oa2, d1h8ob2
   part of anti-ampicillin scFv

Details for d1h8oa1

PDB Entry: 1h8o, 2.75 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment.

PDB Compounds: (A:) mutant al2 6e7p9g

SCOP Domain Sequences for d1h8oa1:

Sequence; same for both SEQRES and ATOM records:

>d1h8oa1 b.1.1.1 (A:4-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkr

Timeline for d1h8oa1:

• d1h8oa1 first appeared in SCOP 1.57
  
• d1h8oa1 appears in SCOP 1.73
  
• d1h8oa1 appears in SCOPe 2.01
  
• d1h8oa1 appears in the current release, SCOPe 2.08