Lineage for d1h8na2 (1h8n A:132-243)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652599Domain d1h8na2: 1h8n A:132-243 [60784]
    Other proteins in same PDB: d1h8na1
    part of anti-ampicillin scFv
    complexed with gol, so4; mutant

Details for d1h8na2

PDB Entry: 1h8n (more details), 1.87 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment from phage-displayed murine antibody libraries
PDB Compounds: (A:) mutant al2 6e7s9g

SCOP Domain Sequences for d1h8na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8na2 b.1.1.1 (A:132-243) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqesggelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytny
nqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvsa

SCOP Domain Coordinates for d1h8na2:

Click to download the PDB-style file with coordinates for d1h8na2.
(The format of our PDB-style files is described here.)

Timeline for d1h8na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h8na1