SCOP 1.65: Domain d1h8na2: 1h8n A:132-243

Lineage for d1h8na2 (1h8n A:132-243)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1h8na2: 1h8n A:132-243 [60784]
   Other proteins in same PDB: d1h8na1
   part of anti-ampicillin scFv
   complexed with gol, so4; mutant

Details for d1h8na2

PDB Entry: 1h8n, 1.87 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment from phage-displayed murine antibody libraries

SCOP Domain Sequences for d1h8na2:

Sequence; same for both SEQRES and ATOM records:

>d1h8na2 b.1.1.1 (A:132-243) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqesggelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytny
nqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvsa

Timeline for d1h8na2:

• d1h8na2 first appeared in SCOP 1.57
  
• d1h8na2 appears in SCOP 1.63
  
• d1h8na2 appears in SCOP 1.67
  
• d1h8na2 appears in the current release, SCOPe 2.08