Lineage for d1h8na1 (1h8n A:3-109)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157433Species Anti-ampicillin scFv, (mouse), kappa L chain [63645] (4 PDB entries)
  8. 157434Domain d1h8na1: 1h8n A:3-109 [60783]

Details for d1h8na1

PDB Entry: 1h8n (more details), 1.87 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment from phage-displayed murine antibody libraries

SCOP Domain Sequences for d1h8na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8na1 b.1.1.1 (A:3-109) Immunoglobulin (variable domains of L and H chains) {Anti-ampicillin scFv, (mouse), kappa L chain}
kdivltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvp
drftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklel

SCOP Domain Coordinates for d1h8na1:

Click to download the PDB-style file with coordinates for d1h8na1.
(The format of our PDB-style files is described here.)

Timeline for d1h8na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h8na2