Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold |
Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein) |
Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries) Uniprot P05631 |
Domain d1h8hg_: 1h8h G: [60777] Other proteins in same PDB: d1h8ha1, d1h8ha2, d1h8ha3, d1h8hb1, d1h8hb2, d1h8hb3, d1h8hc1, d1h8hc2, d1h8hc3, d1h8hd1, d1h8hd2, d1h8hd3, d1h8he1, d1h8he2, d1h8he3, d1h8hf1, d1h8hf2, d1h8hf3 core domain is disordered; only coiled coil part is visible complexed with adp, atp, gol, mg, po4 |
PDB Entry: 1h8h (more details), 2.9 Å
SCOPe Domain Sequences for d1h8hg_:
Sequence, based on SEQRES records: (download)
>d1h8hg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]} atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas emidkltltfnrtrqavitkelieiisgaaal
>d1h8hg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]} atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa al
Timeline for d1h8hg_: