SCOP 1.59: Domain d1h8hf2: 1h8h F:9-81

Lineage for d1h8hf2 (1h8h F:9-81)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)

8. Domain d1h8hf2: 1h8h F:9-81 [60775]
   Other proteins in same PDB: d1h8ha1, d1h8ha3, d1h8hb1, d1h8hb3, d1h8hc1, d1h8hc3, d1h8hd1, d1h8hd3, d1h8he1, d1h8he3, d1h8hf1, d1h8hf3, d1h8hg_

Details for d1h8hf2

PDB Entry: 1h8h, 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp

SCOP Domain Sequences for d1h8hf2:

Sequence; same for both SEQRES and ATOM records:

>d1h8hf2 b.49.1.1 (F:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1h8hf2:

• d1h8hf2 first appeared in SCOP 1.57
  
• d1h8hf2 appears in SCOP 1.61
  
• d1h8hf2 appears in the current release, SCOPe 2.08