Class b: All beta proteins [48724] (110 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein) |
Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries) |
Domain d1h8hf2: 1h8h F:9-81 [60775] Other proteins in same PDB: d1h8ha1, d1h8ha3, d1h8hb1, d1h8hb3, d1h8hc1, d1h8hc3, d1h8hd1, d1h8hd3, d1h8he1, d1h8he3, d1h8hf1, d1h8hf3, d1h8hg_ |
PDB Entry: 1h8h (more details), 2.9 Å
SCOP Domain Sequences for d1h8hf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8hf2 b.49.1.1 (F:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg lvrgqkvldsgap
Timeline for d1h8hf2: