Class a: All alpha proteins [46456] (151 folds) |
Fold a.69: Left-handed superhelix [47916] (3 superfamilies) |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein) |
Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries) |
Domain d1h8hc1: 1h8h C:380-510 [60765] Other proteins in same PDB: d1h8ha2, d1h8ha3, d1h8hb2, d1h8hb3, d1h8hc2, d1h8hc3, d1h8hd2, d1h8hd3, d1h8he2, d1h8he3, d1h8hf2, d1h8hf3, d1h8hg_ |
PDB Entry: 1h8h (more details), 2.9 Å
SCOP Domain Sequences for d1h8hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8hc1 a.69.1.1 (C:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d1h8hc1: