Lineage for d1h8hc1 (1h8h C:380-510)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154205Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
  4. 154206Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 154207Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 154208Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 154212Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)
  8. 154257Domain d1h8hc1: 1h8h C:380-510 [60765]
    Other proteins in same PDB: d1h8ha2, d1h8ha3, d1h8hb2, d1h8hb3, d1h8hc2, d1h8hc3, d1h8hd2, d1h8hd3, d1h8he2, d1h8he3, d1h8hf2, d1h8hf3, d1h8hg_

Details for d1h8hc1

PDB Entry: 1h8h (more details), 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp

SCOP Domain Sequences for d1h8hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8hc1 a.69.1.1 (C:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d1h8hc1:

Click to download the PDB-style file with coordinates for d1h8hc1.
(The format of our PDB-style files is described here.)

Timeline for d1h8hc1: