SCOPe 2.01: Domain d1h8hb2: 1h8h B:24-94

Lineage for d1h8hb2 (1h8h B:24-94)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88673] (14 PDB entries)
   Uniprot P19483

8. Domain d1h8hb2: 1h8h B:24-94 [60763]
   Other proteins in same PDB: d1h8ha1, d1h8ha3, d1h8hb1, d1h8hb3, d1h8hc1, d1h8hc3, d1h8hd1, d1h8hd2, d1h8hd3, d1h8he1, d1h8he2, d1h8he3, d1h8hf1, d1h8hf2, d1h8hf3, d1h8hg_
   complexed with adp, atp, gol, mg, po4

Details for d1h8hb2

PDB Entry: 1h8h, 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp

PDB Compounds: (B:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8hb2:

Sequence; same for both SEQRES and ATOM records:

>d1h8hb2 b.49.1.1 (B:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

Timeline for d1h8hb2:

• d1h8hb2 first appeared in SCOP 1.57
  
• d1h8hb2 appears in SCOP 1.75
  
• d1h8hb2 appears in SCOPe 2.02
  
• d1h8hb2 appears in the current release, SCOPe 2.08