Class b: All beta proteins [48724] (119 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein) |
Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries) |
Domain d1h8hb2: 1h8h B:24-94 [60763] Other proteins in same PDB: d1h8ha1, d1h8ha3, d1h8hb1, d1h8hb3, d1h8hc1, d1h8hc3, d1h8hd1, d1h8hd3, d1h8he1, d1h8he3, d1h8hf1, d1h8hf3, d1h8hg_ |
PDB Entry: 1h8h (more details), 2.9 Å
SCOP Domain Sequences for d1h8hb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8hb2 b.49.1.1 (B:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik egdivkrtgai
Timeline for d1h8hb2: