Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (9 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries) |
Domain d1h8ha3: 1h8h A:95-379 [60761] Other proteins in same PDB: d1h8ha1, d1h8ha2, d1h8hb1, d1h8hb2, d1h8hc1, d1h8hc2, d1h8hd1, d1h8hd2, d1h8he1, d1h8he2, d1h8hf1, d1h8hf2, d1h8hg_ |
PDB Entry: 1h8h (more details), 2.9 Å
SCOP Domain Sequences for d1h8ha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ha3 c.37.1.11 (A:95-379) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq
Timeline for d1h8ha3: