Lineage for d1h8eg_ (1h8e G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880867Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2881030Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2881031Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 2881032Protein F1 ATP synthase gamma subunit [52945] (4 species)
  7. 2881047Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
    Uniprot P05631
  8. 2881061Domain d1h8eg_: 1h8e G: [60756]
    Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eh_, d1h8ei_
    core domain is disordered; only coiled coil part is visible
    complexed with adp, alf, gol, mg, so4

Details for d1h8eg_

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)
PDB Compounds: (G:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8eg_:

Sequence, based on SEQRES records: (download)

>d1h8eg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1h8eg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadilii
gvssdrglcgaihssvakqmkseaanlkevkiigvgdkirsilhtfkevgrrpptfgdas
vialellnegsiifnrfrsvisykteekpifsldtissaesmsiyddidadvlrnyqeys
laniiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisg
aaal

SCOPe Domain Coordinates for d1h8eg_:

Click to download the PDB-style file with coordinates for d1h8eg_.
(The format of our PDB-style files is described here.)

Timeline for d1h8eg_: