Lineage for d1h8ee3 (1h8e E:82-357)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1165223Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1165331Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 1165334Species Cow (Bos taurus) [TaxId:9913] [88780] (14 PDB entries)
    Uniprot P00829
  8. 1165351Domain d1h8ee3: 1h8e E:82-357 [60752]
    Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ee1, d1h8ee2, d1h8ef1, d1h8ef2, d1h8eg_, d1h8eh_, d1h8ei_
    complexed with adp, alf, gol, mg, so4

Details for d1h8ee3

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)
PDB Compounds: (E:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8ee3:

Sequence, based on SEQRES records: (download)

>d1h8ee3 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

Sequence, based on observed residues (ATOM records): (download)

>d1h8ee3 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemeqeilvtgikvvdll
apyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemies
gvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrftq
agsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpapa
ttfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d1h8ee3:

Click to download the PDB-style file with coordinates for d1h8ee3.
(The format of our PDB-style files is described here.)

Timeline for d1h8ee3: