Lineage for d1h8ee2 (1h8e E:9-81)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1129800Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1129801Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 1129802Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1129855Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 1129858Species Cow (Bos taurus) [TaxId:9913] [88678] (14 PDB entries)
    Uniprot P00829
  8. 1129875Domain d1h8ee2: 1h8e E:9-81 [60751]
    Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed3, d1h8ee1, d1h8ee3, d1h8ef1, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_
    complexed with adp, alf, gol, mg, so4

Details for d1h8ee2

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)
PDB Compounds: (E:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8ee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ee2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d1h8ee2:

Click to download the PDB-style file with coordinates for d1h8ee2.
(The format of our PDB-style files is described here.)

Timeline for d1h8ee2: