Lineage for d1h8ee1 (1h8e E:358-464)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273476Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1273477Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 1273478Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1273534Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 1273537Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 1273575Domain d1h8ee1: 1h8e E:358-464 [60750]
    Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed2, d1h8ed3, d1h8ee2, d1h8ee3, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_
    complexed with adp, alf, gol, mg, so4

Details for d1h8ee1

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)
PDB Compounds: (E:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8ee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ee1 a.69.1.1 (E:358-464) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpie

SCOPe Domain Coordinates for d1h8ee1:

Click to download the PDB-style file with coordinates for d1h8ee1.
(The format of our PDB-style files is described here.)

Timeline for d1h8ee1: