![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries) Uniprot P00829 |
![]() | Domain d1h8ed2: 1h8e D:9-81 [60748] Other proteins in same PDB: d1h8ea1, d1h8ea2, d1h8ea3, d1h8eb1, d1h8eb2, d1h8eb3, d1h8ec1, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed3, d1h8ee1, d1h8ee3, d1h8ef1, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_ complexed with adp, alf, gol, mg, so4 |
PDB Entry: 1h8e (more details), 2 Å
SCOPe Domain Sequences for d1h8ed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ed2 b.49.1.1 (D:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg lvrgqkvldsgap
Timeline for d1h8ed2: